PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR08G10100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 178aa    MW: 20025.3 Da    PI: 8.9599
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR08G10100.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_152.88.7e-173696363
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                     +lkr rrk++NRe+A+rsR+RK++ ++ L+  v +L+ eN++L  +l++ ++ + + ++++
  LPERR08G10100.1 36 DLKRKRRKESNRESAKRSRLRKQQHLDDLTSQVNQLKMENQQLSTTLNMVTQSYTAAEAQN 96
                     79***********************************************999988776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.5E-133190No hitNo description
SMARTSM003381.2E-183498IPR004827Basic-leucine zipper domain
PfamPF001701.3E-133689IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.453699IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.06E-123790No hitNo description
CDDcd147027.61E-223989No hitNo description
PROSITE patternPS0003604156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MSLSGGTLSS GTSSGSSHGT WTSGSEIDIQ LQAQMDLKRK RRKESNRESA KRSRLRKQQH  60
LDDLTSQVNQ LKMENQQLST TLNMVTQSYT AAEAQNSVLR TQKVELDIRL SALRDIIFYM  120
NNANQLPNST ITATTYPSTI MTATTNGHYD YYDVVSANAW SSGMQMMHQP IDQFLYQC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13742KRKRRK
23843RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015651067.13e-95PREDICTED: ocs element-binding factor 1
TrEMBLA0A0D9X7411e-130A0A0D9X741_9ORYZ; Uncharacterized protein
STRINGLOC_Os08g26880.19e-95(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37403276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34590.15e-16G-box binding factor 6